Lineage for d1dysa_ (1dys A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21208Fold c.6: Cellulases [51988] (1 superfamily)
  4. 21209Superfamily c.6.1: Cellulases [51989] (1 family) (S)
  5. 21210Family c.6.1.1: Cellulases [51990] (2 proteins)
  6. 21211Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 21216Species Humicola insolens, Cel6b [TaxId:34413] [51996] (1 PDB entry)
  8. 21217Domain d1dysa_: 1dys A: [30669]

Details for d1dysa_

PDB Entry: 1dys (more details), 1.6 Å

PDB Description: endoglucanase cel6b from humicola insolens

SCOP Domain Sequences for d1dysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dysa_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6b}
gnpfsgrtllvnsdysskldqtrqaflsrgdqtnaakvkyvqekvgtfywisnifllrdi
dvaiqnaraakargenpivglvlynlpdrdcsagessgelklsqnglnrykneyvnpfaq
klkaasdvqfavilepdaignmvtgtsafcrnargpqqeaigyaisqlqashihlyldva
nggwlgwadkleptaqevatilqkagnnakirgfssnvsnynpystsnpppytsgspspd
esryatnianamrqrglptqfiidqsrvalsgarsewgqwcnvnpagfgqpfttntnnpn
vdaivwvkpggesdgqcgmggapaagmwfdayaqmltqnahdeia

SCOP Domain Coordinates for d1dysa_:

Click to download the PDB-style file with coordinates for d1dysa_.
(The format of our PDB-style files is described here.)

Timeline for d1dysa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dysb_