Lineage for d1bvwa_ (1bvw A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21208Fold c.6: Cellulases [51988] (1 superfamily)
  4. 21209Superfamily c.6.1: Cellulases [51989] (1 family) (S)
  5. 21210Family c.6.1.1: Cellulases [51990] (2 proteins)
  6. 21211Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 21212Species Humicola insolens, Cel6a [TaxId:34413] [51995] (2 PDB entries)
  8. 21215Domain d1bvwa_: 1bvw A: [30668]

Details for d1bvwa_

PDB Entry: 1bvw (more details), 1.92 Å

PDB Description: cellobiohydrolase ii (cel6a) from humicola insolens

SCOP Domain Sequences for d1bvwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvwa_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a}
gnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllvq
tlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrirei
lisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymdag
hagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpnyd
ekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantghq
yvdafvwvkpggecdgtsdttaarydyhcgledalkpapeagqwfneyfiqllrnanppf

SCOP Domain Coordinates for d1bvwa_:

Click to download the PDB-style file with coordinates for d1bvwa_.
(The format of our PDB-style files is described here.)

Timeline for d1bvwa_: