Lineage for d1bvwa_ (1bvw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850483Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2850484Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2850485Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 2850486Species Humicola insolens, Cel6a [TaxId:34413] [51995] (9 PDB entries)
  8. 2850497Domain d1bvwa_: 1bvw A: [30668]
    complexed with gol, man, mg, nag

Details for d1bvwa_

PDB Entry: 1bvw (more details), 1.92 Å

PDB Description: cellobiohydrolase ii (cel6a) from humicola insolens
PDB Compounds: (A:) protein (cellobiohydrolase II)

SCOPe Domain Sequences for d1bvwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvwa_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a [TaxId: 34413]}
gnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllvq
tlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrirei
lisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymdag
hagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpnyd
ekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantghq
yvdafvwvkpggecdgtsdttaarydyhcgledalkpapeagqwfneyfiqllrnanppf

SCOPe Domain Coordinates for d1bvwa_:

Click to download the PDB-style file with coordinates for d1bvwa_.
(The format of our PDB-style files is described here.)

Timeline for d1bvwa_: