Lineage for d2bvwb_ (2bvw B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67524Fold c.6: Cellulases [51988] (1 superfamily)
  4. 67525Superfamily c.6.1: Cellulases [51989] (1 family) (S)
  5. 67526Family c.6.1.1: Cellulases [51990] (2 proteins)
  6. 67527Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 67528Species Humicola insolens, Cel6a [TaxId:34413] [51995] (2 PDB entries)
  8. 67530Domain d2bvwb_: 2bvw B: [30667]

Details for d2bvwb_

PDB Entry: 2bvw (more details), 1.7 Å

PDB Description: cellobiohydrolase ii (cel6a) from humicola insolens in complex with glucose and cellotetraose

SCOP Domain Sequences for d2bvwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvwb_ c.6.1.1 (B:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a}
gnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllvq
tlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrirei
lisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymdag
hagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpnyd
ekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantghq
yvdafvwvkpggecdgtsdttaarydyhcgledalkpapeagqwfneyfiqllrnanppf

SCOP Domain Coordinates for d2bvwb_:

Click to download the PDB-style file with coordinates for d2bvwb_.
(The format of our PDB-style files is described here.)

Timeline for d2bvwb_: