SCOPe 2.08: Domain d3uh9a1: 3uh9 A:2-139

Lineage for d3uh9a1 (3uh9 A:2-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [226573] (4 PDB entries)

8. Domain d3uh9a1: 3uh9 A:2-139 [306657]
   Other proteins in same PDB: d3uh9a2
   automated match to d4jd1b_
   complexed with edo, fcn, zn

Details for d3uh9a1

PDB Entry: 3uh9, 1.6 Å

PDB Description: Crystal Structure of Metallothiol Transferase FosB 2 from Bacillus anthracis str. Ames

PDB Compounds: (A:) Metallothiol transferase fosB 2

SCOPe Domain Sequences for d3uh9a1:

Sequence; same for both SEQRES and ATOM records:

>d3uh9a1 d.32.1.0 (A:2-139) automated matches {Bacillus anthracis [TaxId: 198094]}
lqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprneik
qsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgtl
qnrleyykedkkhmtfyi

Timeline for d3uh9a1:

• d3uh9a1 first appeared in SCOPe 2.06
  
• d3uh9a1 appears in SCOPe 2.07