Lineage for d3ueka_ (3uek A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120592Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2120593Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2120716Family c.50.1.3: Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain-like [310642] (2 protein domains)
    Pfam PF05028
    Contains N- and C-terminal extensions to macrodomain, including Tyr clasp, discussed in PubMed 22609859
  6. 2120717Protein Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain [310785] (3 species)
  7. 2120735Species Norway rat (Rattus norvegicus) [TaxId:10116] [311041] (2 PDB entries)
  8. 2120736Domain d3ueka_: 3uek A: [306650]

Details for d3ueka_

PDB Entry: 3uek (more details), 1.95 Å

PDB Description: Crystal structure of the catalytic domain of rat poly (ADP-ribose) glycohydrolase
PDB Compounds: (A:) Poly(ADP-ribose) glycohydrolase

SCOPe Domain Sequences for d3ueka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ueka_ c.50.1.3 (A:) Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yvppnlppdkkwlgtpieemrkmprcgvrlpllrpsashtvtvrvdllragevpkpfpth
ykdlwdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkyn
vayskkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnh
svtmsqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfc
yfrrvtekkptglvtftrqsledfpewercdkpltrlhvtyegtiegngrgmlqvdfanr
fvgggvtgaglvqeeirflinpelivsrlftevldhnecliitgteqyseytgyaetyrw
arshedgsekddwqrccteivaidalhfrryldqfvpekvrrelnkaycgflrpgvppen
lsavatgnwgcgafggdarlkaliqllaaaaaerdvvyftfgdselmrdiysmhtflter
klnvgkvyrlllryyreecrdcsspgpdtklypfiyhaaes

SCOPe Domain Coordinates for d3ueka_:

Click to download the PDB-style file with coordinates for d3ueka_.
(The format of our PDB-style files is described here.)

Timeline for d3ueka_:

  • d3ueka_ is new in SCOPe 2.06-stable