SCOPe 2.08: Domain d3u59a1: 3u59 A:1-98

Lineage for d3u59a1 (3u59 A:1-98)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.5: Tropomyosin [57997] (2 families)

5. Family h.1.5.0: automated matches [254317] (1 protein)
   not a true family

6. Protein automated matches [254727] (1 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [256109] (3 PDB entries)

8. Domain d3u59a1: 3u59 A:1-98 [306632]
   Other proteins in same PDB: d3u59a2, d3u59b2, d3u59c2, d3u59d2
   automated match to d3u1ca_

Details for d3u59a1

PDB Entry: 3u59, 2.5 Å

PDB Description: N-terminal 98-aa fragment of smooth muscle tropomyosin beta

PDB Compounds: (A:) Tropomyosin beta chain

SCOPe Domain Sequences for d3u59a1:

Sequence; same for both SEQRES and ATOM records:

>d3u59a1 h.1.5.0 (A:1-98) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
meaikkkmqmlkldkenaidraeqaeadkkqaedrckqleeeqqglqkklkgtedeveky
sesvkeaqekleqaekkatdaeaevaslnrriqlveee

Timeline for d3u59a1:

• d3u59a1 first appeared in SCOPe 2.06
  
• d3u59a1 appears in SCOPe 2.07