Lineage for d3u20a1 (3u20 A:238-606)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469427Species Trypanosoma brucei [TaxId:999953] [226467] (29 PDB entries)
  8. 2469434Domain d3u20a1: 3u20 A:238-606 [306627]
    Other proteins in same PDB: d3u20a2, d3u20b2, d3u20b3
    automated match to d4eg8b1
    protein/RNA complex; complexed with 44f, dms, gol, met

Details for d3u20a1

PDB Entry: 3u20 (more details), 2.49 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1444
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3u20a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u20a1 c.26.1.0 (A:238-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdkn
miarlngel

SCOPe Domain Coordinates for d3u20a1:

Click to download the PDB-style file with coordinates for d3u20a1.
(The format of our PDB-style files is described here.)

Timeline for d3u20a1: