| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
| Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
| Protein automated matches [226872] (13 species) not a true protein |
| Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries) |
| Domain d3u1zb2: 3u1z B:607-767 [306625] Other proteins in same PDB: d3u1za1, d3u1zb1, d3u1zb3 automated match to d4eg8b2 protein/RNA complex; complexed with 43e, dms, gol, met, so4 |
PDB Entry: 3u1z (more details), 2.9 Å
SCOPe Domain Sequences for d3u1zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u1zb2 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst
Timeline for d3u1zb2: