Lineage for d3u1zb1 (3u1z B:237-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106228Species Trypanosoma brucei [TaxId:999953] [226467] (27 PDB entries)
  8. 2106257Domain d3u1zb1: 3u1z B:237-606 [306624]
    Other proteins in same PDB: d3u1za2, d3u1zb2, d3u1zb3
    automated match to d4eg8b1
    protein/RNA complex; complexed with 43e, dms, gol, met, so4

Details for d3u1zb1

PDB Entry: 3u1z (more details), 2.9 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1433
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3u1zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u1zb1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea
akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl
gryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerl
lewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwld
altnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsagl
plpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdk
nmiarlngel

SCOPe Domain Coordinates for d3u1zb1:

Click to download the PDB-style file with coordinates for d3u1zb1.
(The format of our PDB-style files is described here.)

Timeline for d3u1zb1:

  • d3u1zb1 is new in SCOPe 2.06-stable