Lineage for d1cb2b_ (1cb2 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67524Fold c.6: Cellulases [51988] (1 superfamily)
  4. 67525Superfamily c.6.1: Cellulases [51989] (1 family) (S)
  5. 67526Family c.6.1.1: Cellulases [51990] (2 proteins)
  6. 67527Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 67535Species Trichoderma reesei, Cel6a [TaxId:51453] [51994] (5 PDB entries)
  8. 67541Domain d1cb2b_: 1cb2 B: [30662]

Details for d1cb2b_

PDB Entry: 1cb2 (more details), 2 Å

PDB Description: cellobiohydrolase ii, catalytic domain, mutant y169f

SCOP Domain Sequences for d1cb2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb2b_ c.6.1.1 (B:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a}
tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
meqtladirtanknggnyagqfvvfdlpdrdcaalasngeysiadggvakyknyidtirq
ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
sfl

SCOP Domain Coordinates for d1cb2b_:

Click to download the PDB-style file with coordinates for d1cb2b_.
(The format of our PDB-style files is described here.)

Timeline for d1cb2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cb2a_