Lineage for d3u1ea2 (3u1e A:607-768)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991903Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1991904Protein automated matches [226872] (8 species)
    not a true protein
  7. 1991925Species Trypanosoma brucei [TaxId:999953] [226468] (27 PDB entries)
  8. 1991932Domain d3u1ea2: 3u1e A:607-768 [306608]
    Other proteins in same PDB: d3u1ea1, d3u1eb3, d3u1eb5
    automated match to d4eg8b2
    protein/RNA complex; complexed with 387, dms, gol, met

Details for d3u1ea2

PDB Entry: 3u1e (more details), 2.31 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1387
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3u1ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u1ea2 a.27.1.0 (A:607-768) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste

SCOPe Domain Coordinates for d3u1ea2:

Click to download the PDB-style file with coordinates for d3u1ea2.
(The format of our PDB-style files is described here.)

Timeline for d3u1ea2:

  • d3u1ea2 is new in SCOPe 2.06-stable