| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
| Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
| Protein automated matches [226872] (13 species) not a true protein |
| Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries) |
| Domain d3u1ea2: 3u1e A:607-768 [306608] Other proteins in same PDB: d3u1ea1, d3u1eb3, d3u1eb5 automated match to d4eg8b2 protein/RNA complex; complexed with 387, dms, gol, met |
PDB Entry: 3u1e (more details), 2.31 Å
SCOPe Domain Sequences for d3u1ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u1ea2 a.27.1.0 (A:607-768) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste
Timeline for d3u1ea2: