SCOPe 2.08: Domain d3tunb4: 3tun B:607-767

Lineage for d3tunb4 (3tun B:607-767)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries)

8. Domain d3tunb4: 3tun B:607-767 [306603]
   Other proteins in same PDB: d3tuna1, d3tunb3, d3tunb5
   automated match to d4eg8b2
   protein/RNA complex; complexed with c13, dms, gol, met

Details for d3tunb4

PDB Entry: 3tun, 2.55 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1356

PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3tunb4:

Sequence; same for both SEQRES and ATOM records:

>d3tunb4 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

Timeline for d3tunb4:

• d3tunb4 first appeared in SCOPe 2.06
  
• d3tunb4 appears in SCOPe 2.07