Lineage for d1qk2b_ (1qk2 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21208Fold c.6: Cellulases [51988] (1 superfamily)
  4. 21209Superfamily c.6.1: Cellulases [51989] (1 family) (S)
  5. 21210Family c.6.1.1: Cellulases [51990] (2 proteins)
  6. 21211Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 21219Species Trichoderma reesei, Cel6a [TaxId:51453] [51994] (5 PDB entries)
  8. 21223Domain d1qk2b_: 1qk2 B: [30660]

Details for d1qk2b_

PDB Entry: 1qk2 (more details), 2 Å

PDB Description: wild type cel6a with a non-hydrolysable cellotetraose

SCOP Domain Sequences for d1qk2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qk2b_ c.6.1.1 (B:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a}
tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq
ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
sfl

SCOP Domain Coordinates for d1qk2b_:

Click to download the PDB-style file with coordinates for d1qk2b_.
(The format of our PDB-style files is described here.)

Timeline for d1qk2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qk2a_