Lineage for d1qk2b_ (1qk2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850483Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2850484Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2850485Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 2850501Species Trichoderma reesei, Cel6a [TaxId:51453] [51994] (7 PDB entries)
  8. 2850508Domain d1qk2b_: 1qk2 B: [30660]
    complexed with glc, man, mgl, nag, sgc

Details for d1qk2b_

PDB Entry: 1qk2 (more details), 2 Å

PDB Description: wild type cel6a with a non-hydrolysable cellotetraose
PDB Compounds: (B:) cellobiohydrolase cel6a (formerly called cbh II)

SCOPe Domain Sequences for d1qk2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qk2b_ c.6.1.1 (B:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a [TaxId: 51453]}
tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq
ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
sfl

SCOPe Domain Coordinates for d1qk2b_:

Click to download the PDB-style file with coordinates for d1qk2b_.
(The format of our PDB-style files is described here.)

Timeline for d1qk2b_: