![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein Phospholipase A2 [48637] (5 species) |
![]() | Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (23 PDB entries) |
![]() | Domain d3tt5a_: 3tt5 A: [306593] automated match to d1l8sa_ complexed with ber, ca |
PDB Entry: 3tt5 (more details), 2.3 Å
SCOPe Domain Sequences for d3tt5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tt5a_ a.133.1.2 (A:) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]} alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt kkyc
Timeline for d3tt5a_: