Lineage for d1qk2a_ (1qk2 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119500Fold c.6: Cellulases [51988] (1 superfamily)
  4. 119501Superfamily c.6.1: Cellulases [51989] (1 family) (S)
  5. 119502Family c.6.1.1: Cellulases [51990] (2 proteins)
  6. 119503Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 119511Species Trichoderma reesei, Cel6a [TaxId:51453] [51994] (7 PDB entries)
  8. 119514Domain d1qk2a_: 1qk2 A: [30659]

Details for d1qk2a_

PDB Entry: 1qk2 (more details), 2 Å

PDB Description: wild type cel6a with a non-hydrolysable cellotetraose

SCOP Domain Sequences for d1qk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qk2a_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a}
tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq
ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
sfl

SCOP Domain Coordinates for d1qk2a_:

Click to download the PDB-style file with coordinates for d1qk2a_.
(The format of our PDB-style files is described here.)

Timeline for d1qk2a_: