Lineage for d3tosj_ (3tos J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894401Family c.66.1.61: TylF O-methyltransferase-like [310662] (4 proteins)
    Pfam PF05711
  6. 2894402Protein Calicheamicin methyltransferase CalS11 [310829] (1 species)
  7. 2894403Species Micromonospora echinospora [TaxId:1877] [311098] (1 PDB entry)
  8. 2894413Domain d3tosj_: 3tos J: [306583]
    Other proteins in same PDB: d3tosb2
    complexed with edo, glu, na, sah

Details for d3tosj_

PDB Entry: 3tos (more details), 1.55 Å

PDB Description: crystal structure of cals11, calicheamicin methyltransferase
PDB Compounds: (J:) CalS11

SCOPe Domain Sequences for d3tosj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tosj_ c.66.1.61 (J:) Calicheamicin methyltransferase CalS11 {Micromonospora echinospora [TaxId: 1877]}
qdlrafvhdspeetettqrltklltnspipteelvnnlplflrrhqmtdllsmdalyrqv
ldvpgvimefgvrfgrhlgtfaalrgvyepynplrrivgfdtftgfpdvndvdrvgptay
qgrfavpggypaylkevldahecsdffghvtqrsvlvegdvretvprylaenpqtviala
yfdldlyeptkavleairpyltkgsivafdeldnpkwpgeniamrkvlgldhaplrllpg
rpapaylrwgd

SCOPe Domain Coordinates for d3tosj_:

Click to download the PDB-style file with coordinates for d3tosj_.
(The format of our PDB-style files is described here.)

Timeline for d3tosj_: