Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187277] (23 PDB entries) |
Domain d3tn1b1: 3tn1 B:3-69 [306566] Other proteins in same PDB: d3tn1a2, d3tn1b2, d3tn1d2, d3tn1e2 automated match to d4ra8b_ complexed with zn; mutant |
PDB Entry: 3tn1 (more details), 2.6 Å
SCOPe Domain Sequences for d3tn1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tn1b1 d.9.1.1 (B:3-69) automated matches {Human (Homo sapiens) [TaxId: 9606]} laadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky vsdlels
Timeline for d3tn1b1: