Lineage for d3tn1a1 (3tn1 A:3-69)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929310Protein automated matches [190403] (4 species)
    not a true protein
  7. 2929318Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries)
  8. 2929358Domain d3tn1a1: 3tn1 A:3-69 [306564]
    Other proteins in same PDB: d3tn1a2, d3tn1b2, d3tn1d2, d3tn1e2
    automated match to d4ra8b_
    complexed with zn; mutant

Details for d3tn1a1

PDB Entry: 3tn1 (more details), 2.6 Å

PDB Description: Structure analysis of the Mip1a P8A mutant
PDB Compounds: (A:) C-C motif chemokine 3

SCOPe Domain Sequences for d3tn1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tn1a1 d.9.1.1 (A:3-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky
vsdlels

SCOPe Domain Coordinates for d3tn1a1:

Click to download the PDB-style file with coordinates for d3tn1a1.
(The format of our PDB-style files is described here.)

Timeline for d3tn1a1: