Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Methanosarcina mazei [TaxId:192952] [311201] (4 PDB entries) |
Domain d3tivb3: 3tiv B:351-460 [306563] Other proteins in same PDB: d3tiva1, d3tiva2, d3tivb1, d3tivb2 automated match to d3j9tb3 complexed with 1pe, aes, cl, gol, pg0, pg4; mutant |
PDB Entry: 3tiv (more details), 1.75 Å
SCOPe Domain Sequences for d3tivb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tivb3 a.69.1.0 (B:351-460) automated matches {Methanosarcina mazei [TaxId: 192952]} mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahrkak
Timeline for d3tivb3: