Lineage for d1tmla_ (1tml A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110411Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2110412Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2110413Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2110444Protein Cellulase E2 [51991] (1 species)
  7. 2110445Species Thermobifida fusca YX [TaxId:269800] [51992] (5 PDB entries)
  8. 2110450Domain d1tmla_: 1tml A: [30656]
    complexed with so4

Details for d1tmla_

PDB Entry: 1tml (more details), 1.8 Å

PDB Description: crystal structure of the catalytic domain of a thermophilic endocellulase
PDB Compounds: (A:) endo-1,4-beta-d-glucanase

SCOPe Domain Sequences for d1tmla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmla_ c.6.1.1 (A:) Cellulase E2 {Thermobifida fusca YX [TaxId: 269800]}
ndspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsa
aqaagkipilvvynapgrdcgnhssggapshsayrswidefaaglknrpayiivepdlis
lmsscmqhvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisns
ahgiatntsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraig
tpsttntgdpmidaflwiklpgeadgciagagqfvpqaayemaiaa

SCOPe Domain Coordinates for d1tmla_:

Click to download the PDB-style file with coordinates for d1tmla_.
(The format of our PDB-style files is described here.)

Timeline for d1tmla_: