Lineage for d1tml__ (1tml -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577009Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 577010Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (1 family) (S)
  5. 577011Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (3 protein domains)
    Pfam 01341
  6. 577042Protein Cellulase E2 [51991] (1 species)
  7. 577043Species Thermomonospora fusca, strain yx [TaxId:269800] [51992] (1 PDB entry)
  8. 577044Domain d1tml__: 1tml - [30656]
    complexed with so4

Details for d1tml__

PDB Entry: 1tml (more details), 1.8 Å

PDB Description: crystal structure of the catalytic domain of a thermophilic endocellulase

SCOP Domain Sequences for d1tml__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tml__ c.6.1.1 (-) Cellulase E2 {Thermomonospora fusca, strain yx}
ndspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsa
aqaagkipilvvynapgrdcgnhssggapshsayrswidefaaglknrpayiivepdlis
lmsscmqhvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisns
ahgiatntsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraig
tpsttntgdpmidaflwiklpgeadgciagagqfvpqaayemaiaa

SCOP Domain Coordinates for d1tml__:

Click to download the PDB-style file with coordinates for d1tml__.
(The format of our PDB-style files is described here.)

Timeline for d1tml__: