SCOP 1.65: Domain d1tml__: 1tml -

Lineage for d1tml__ (1tml -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.1: Cellulases [51989] (1 family)

5. Family c.6.1.1: Cellulases [51990] (2 proteins)

6. Protein Cellulase E2 [51991] (1 species)

7. Species Thermomonospora fusca, strain yx [TaxId:269800] [51992] (1 PDB entry)

8. Domain d1tml__: 1tml - [30656]
   complexed with so4

Details for d1tml__

PDB Entry: 1tml, 1.8 Å

PDB Description: crystal structure of the catalytic domain of a thermophilic endocellulase

SCOP Domain Sequences for d1tml__:

Sequence; same for both SEQRES and ATOM records:

>d1tml__ c.6.1.1 (-) Cellulase E2 {Thermomonospora fusca, strain yx}
ndspfyvnpnmssaewvrnnpndprtpvirdriasvpqgtwfahhnpgqitgqvdalmsa
aqaagkipilvvynapgrdcgnhssggapshsayrswidefaaglknrpayiivepdlis
lmsscmqhvqqevletmayagkalkagssqariyfdaghsawhspaqmaswlqqadisns
ahgiatntsnyrwtadevayakavlsaignpslravidtsrngngpagnewcdpsgraig
tpsttntgdpmidaflwiklpgeadgciagagqfvpqaayemaiaa

Timeline for d1tml__:

• d1tml__ first appeared (with stable ids) in SCOP 1.55
  
• d1tml__ appears in SCOP 1.63
  
• d1tml__ appears in SCOP 1.67
  
• d1tml__ appears in the current release, SCOPe 2.08, called d1tmla_