Lineage for d3tiva2 (3tiv A:76-350)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128892Species Methanosarcina mazei [TaxId:192952] [311200] (4 PDB entries)
  8. 2128898Domain d3tiva2: 3tiv A:76-350 [306559]
    Other proteins in same PDB: d3tiva1, d3tiva3, d3tivb1, d3tivb3
    automated match to d3j9tb2
    complexed with 1pe, aes, cl, gol, pg0, pg4; mutant

Details for d3tiva2

PDB Entry: 3tiv (more details), 1.75 Å

PDB Description: Crystal structure of subunit B mutant N157A of the A1AO ATP synthase
PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3tiva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tiva2 c.37.1.0 (A:76-350) automated matches {Methanosarcina mazei [TaxId: 192952]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphaeialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaarnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpip
dlsgyitegqivvarelhrkgiyppinvlpslsrl

SCOPe Domain Coordinates for d3tiva2:

Click to download the PDB-style file with coordinates for d3tiva2.
(The format of our PDB-style files is described here.)

Timeline for d3tiva2: