| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (130 species) not a true protein |
| Species Methanosarcina mazei [TaxId:192952] [311200] (4 PDB entries) |
| Domain d3tiva2: 3tiv A:76-350 [306559] Other proteins in same PDB: d3tiva1, d3tiva3, d3tivb1, d3tivb3 automated match to d3j9tb2 complexed with 1pe, aes, cl, gol, pg0, pg4; mutant |
PDB Entry: 3tiv (more details), 1.75 Å
SCOPe Domain Sequences for d3tiva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tiva2 c.37.1.0 (A:76-350) automated matches {Methanosarcina mazei [TaxId: 192952]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphaeialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaarnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpip
dlsgyitegqivvarelhrkgiyppinvlpslsrl
Timeline for d3tiva2: