SCOPe 2.08: Domain d3tiva2: 3tiv A:76-350

Lineage for d3tiva2 (3tiv A:76-350)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [311200] (4 PDB entries)

8. Domain d3tiva2: 3tiv A:76-350 [306559]
   Other proteins in same PDB: d3tiva1, d3tiva3, d3tivb1, d3tivb3
   automated match to d3j9tb2
   complexed with 1pe, aes, cl, gol, pg0, pg4; mutant

Details for d3tiva2

PDB Entry: 3tiv, 1.75 Å

PDB Description: Crystal structure of subunit B mutant N157A of the A1AO ATP synthase

PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3tiva2:

Sequence; same for both SEQRES and ATOM records:

>d3tiva2 c.37.1.0 (A:76-350) automated matches {Methanosarcina mazei [TaxId: 192952]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphaeialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaarnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpip
dlsgyitegqivvarelhrkgiyppinvlpslsrl

Timeline for d3tiva2:

• d3tiva2 first appeared in SCOPe 2.06
  
• d3tiva2 appears in SCOPe 2.07