SCOPe 2.06: Domain d3tiva1: 3tiv A:12-75

Lineage for d3tiva1 (3tiv A:12-75)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (11 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [311341] (3 PDB entries)

8. Domain d3tiva1: 3tiv A:12-75 [306558]
   Other proteins in same PDB: d3tiva2, d3tiva3, d3tivb2, d3tivb3
   automated match to d3j9tb1
   complexed with 1pe, aes, cl, gol, pg0, pg4; mutant

Details for d3tiva1

PDB Entry: 3tiv, 1.75 Å

PDB Description: Crystal structure of subunit B mutant N157A of the A1AO ATP synthase

PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3tiva1:

Sequence, based on SEQRES records:

>d3tiva1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgvif
tget

Sequence, based on observed residues (ATOM records):

>d3tiva1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegviftget

Timeline for d3tiva1:

• d3tiva1 is new in SCOPe 2.06-stable
  
• d3tiva1 appears in SCOPe 2.07
  
• d3tiva1 appears in the current release, SCOPe 2.08