Lineage for d3tiva1 (3tiv A:12-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798936Species Methanosarcina mazei [TaxId:192952] [311341] (3 PDB entries)
  8. 2798939Domain d3tiva1: 3tiv A:12-75 [306558]
    Other proteins in same PDB: d3tiva2, d3tiva3, d3tivb2, d3tivb3
    automated match to d3j9tb1
    complexed with 1pe, aes, cl, gol, pg0, pg4; mutant

Details for d3tiva1

PDB Entry: 3tiv (more details), 1.75 Å

PDB Description: Crystal structure of subunit B mutant N157A of the A1AO ATP synthase
PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3tiva1:

Sequence, based on SEQRES records: (download)

>d3tiva1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgvif
tget

Sequence, based on observed residues (ATOM records): (download)

>d3tiva1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegviftget

SCOPe Domain Coordinates for d3tiva1:

Click to download the PDB-style file with coordinates for d3tiva1.
(The format of our PDB-style files is described here.)

Timeline for d3tiva1: