Lineage for d3tiib2 (3tii B:77-377)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217619Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2217620Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species)
  7. 2217661Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [310977] (1 PDB entry)
  8. 2217663Domain d3tiib2: 3tii B:77-377 [306554]
    Other proteins in same PDB: d3tiia1, d3tiia3, d3tiib1, d3tiib3
    complexed with anp, mg

Details for d3tiib2

PDB Entry: 3tii (more details), 2.5 Å

PDB Description: Tubulin tyrosine ligase
PDB Compounds: (B:) Ttl protein

SCOPe Domain Sequences for d3tiib2:

Sequence, based on SEQRES records: (download)

>d3tiib2 d.142.1.10 (B:77-377) Tubulin tyrosine ligase (TTL) C-terminal domain {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
lvkliktspeltetctwfpesyviyptnektpamrarnglpdlanaprtdereefrssfn
kkkeneegnvwiaksssgakgegilissdatelldfidnqgqvhviqkylesplllepgh
rkfdirswvlvdnqyniylyregvlrtssepysdtnfqdmtshltnhciqkehsknygry
eegnemffeefnqylvtslninlensilcqikeiirvclsclepaistkylpyhsfqlfg
fdfmvdknlkvwlievngapacaqklyaelckgivdlaissvfplneenhkptednvfik
l

Sequence, based on observed residues (ATOM records): (download)

>d3tiib2 d.142.1.10 (B:77-377) Tubulin tyrosine ligase (TTL) C-terminal domain {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
lvkliktspeltetctwfpesyviypdereefrssfnkkkeneegnvwiaksssegilis
sdatelldfidnqgqvhviqkylesplllepghrkfdirswvlvdnqyniylyregvlrt
ssepynemffeefnqylvtslninlensilcqikeiirvclsclepaistkylpyhsfql
fgfdfmvdknlkvwlievngapacaqklyaelckgivdlaissvfplnnvfikl

SCOPe Domain Coordinates for d3tiib2:

Click to download the PDB-style file with coordinates for d3tiib2.
(The format of our PDB-style files is described here.)

Timeline for d3tiib2: