Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Methanosarcina mazei [TaxId:192952] [311200] (4 PDB entries) |
Domain d3tgwb2: 3tgw B:76-350 [306546] Other proteins in same PDB: d3tgwa1, d3tgwa3, d3tgwb1, d3tgwb3 automated match to d3j9tb2 complexed with aes, cl, gol, p33, pg0, pg4; mutant |
PDB Entry: 3tgw (more details), 1.75 Å
SCOPe Domain Sequences for d3tgwb2:
Sequence, based on SEQRES records: (download)
>d3tgwb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 192952]} lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid gtntlvrgqklpifsasglpaneialqiarqasvpgsesafavvfaamgitneeaqyfms dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea lrqmgaarnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpip dlsgyitegqivvarelhrkgiyppinvlpslsrl
>d3tgwb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 192952]} lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid gtntlvrgqklpifsasglpaneialqiarqasvpgsesafavvfaamgitneeaqyfms dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea lrqmgaapgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpipdlsg yitegqivvarelhrkgiyppinvlpslsrl
Timeline for d3tgwb2: