Lineage for d3tgwb2 (3tgw B:76-350)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114464Species Methanosarcina mazei [TaxId:192952] [311200] (4 PDB entries)
  8. 2114469Domain d3tgwb2: 3tgw B:76-350 [306546]
    Other proteins in same PDB: d3tgwa1, d3tgwa3, d3tgwb1, d3tgwb3
    automated match to d3j9tb2
    complexed with aes, cl, gol, p33, pg0, pg4; mutant

Details for d3tgwb2

PDB Entry: 3tgw (more details), 1.75 Å

PDB Description: crystal structure of subunit b mutant h156a of the a1ao atp synthase
PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3tgwb2:

Sequence, based on SEQRES records: (download)

>d3tgwb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 192952]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglpaneialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaarnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpip
dlsgyitegqivvarelhrkgiyppinvlpslsrl

Sequence, based on observed residues (ATOM records): (download)

>d3tgwb2 c.37.1.0 (B:76-350) automated matches {Methanosarcina mazei [TaxId: 192952]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglpaneialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaapgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpipdlsg
yitegqivvarelhrkgiyppinvlpslsrl

SCOPe Domain Coordinates for d3tgwb2:

Click to download the PDB-style file with coordinates for d3tgwb2.
(The format of our PDB-style files is described here.)

Timeline for d3tgwb2:

  • d3tgwb2 is new in SCOPe 2.06-stable