SCOPe 2.08: Domain d3tgwb1: 3tgw B:10-75

Lineage for d3tgwb1 (3tgw B:10-75)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (17 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [311341] (3 PDB entries)

8. Domain d3tgwb1: 3tgw B:10-75 [306545]
   Other proteins in same PDB: d3tgwa2, d3tgwa3, d3tgwb2, d3tgwb3
   automated match to d3j9tb1
   complexed with aes, cl, gol, p33, pg0, pg4; mutant

Details for d3tgwb1

PDB Entry: 3tgw, 1.75 Å

PDB Description: crystal structure of subunit b mutant h156a of the a1ao atp synthase

PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3tgwb1:

Sequence, based on SEQRES records:

>d3tgwb1 b.49.1.0 (B:10-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
qiagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgv
iftget

Sequence, based on observed residues (ATOM records):

>d3tgwb1 b.49.1.0 (B:10-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
qiagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggviftget

Timeline for d3tgwb1:

• d3tgwb1 first appeared in SCOPe 2.06
  
• d3tgwb1 appears in SCOPe 2.07