| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) ![]() |
| Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
| Protein automated matches [254528] (11 species) not a true protein |
| Species Methanosarcina mazei [TaxId:192952] [311201] (4 PDB entries) |
| Domain d3tgwa3: 3tgw A:351-458 [306544] Other proteins in same PDB: d3tgwa1, d3tgwa2, d3tgwb1, d3tgwb2 automated match to d3j9tb3 complexed with aes, cl, gol, p33, pg0, pg4; mutant |
PDB Entry: 3tgw (more details), 1.75 Å
SCOPe Domain Sequences for d3tgwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tgwa3 a.69.1.0 (A:351-458) automated matches {Methanosarcina mazei [TaxId: 192952]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahrk
Timeline for d3tgwa3: