Lineage for d3tgwa3 (3tgw A:351-458)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002731Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2002732Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2002956Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2002957Protein automated matches [254528] (11 species)
    not a true protein
  7. 2003040Species Methanosarcina mazei [TaxId:192952] [311201] (4 PDB entries)
  8. 2003044Domain d3tgwa3: 3tgw A:351-458 [306544]
    Other proteins in same PDB: d3tgwa1, d3tgwa2, d3tgwb1, d3tgwb2
    automated match to d3j9tb3
    complexed with aes, cl, gol, p33, pg0, pg4; mutant

Details for d3tgwa3

PDB Entry: 3tgw (more details), 1.75 Å

PDB Description: crystal structure of subunit b mutant h156a of the a1ao atp synthase
PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3tgwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgwa3 a.69.1.0 (A:351-458) automated matches {Methanosarcina mazei [TaxId: 192952]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahrk

SCOPe Domain Coordinates for d3tgwa3:

Click to download the PDB-style file with coordinates for d3tgwa3.
(The format of our PDB-style files is described here.)

Timeline for d3tgwa3: