SCOPe 2.08: Domain d3tgwa3: 3tgw A:351-458

Lineage for d3tgwa3 (3tgw A:351-458)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [311201] (4 PDB entries)

8. Domain d3tgwa3: 3tgw A:351-458 [306544]
   Other proteins in same PDB: d3tgwa1, d3tgwa2, d3tgwb1, d3tgwb2
   automated match to d3j9tb3
   complexed with aes, cl, gol, p33, pg0, pg4; mutant

Details for d3tgwa3

PDB Entry: 3tgw, 1.75 Å

PDB Description: crystal structure of subunit b mutant h156a of the a1ao atp synthase

PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3tgwa3:

Sequence; same for both SEQRES and ATOM records:

>d3tgwa3 a.69.1.0 (A:351-458) automated matches {Methanosarcina mazei [TaxId: 192952]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahrk

Timeline for d3tgwa3:

• d3tgwa3 first appeared in SCOPe 2.06
  
• d3tgwa3 appears in SCOPe 2.07