| Class b: All beta proteins [48724] (177 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
| Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
| Protein automated matches [254527] (11 species) not a true protein |
| Species Methanosarcina mazei [TaxId:192952] [311341] (3 PDB entries) |
| Domain d3tgwa1: 3tgw A:11-75 [306542] Other proteins in same PDB: d3tgwa2, d3tgwa3, d3tgwb2, d3tgwb3 automated match to d3j9tb1 complexed with aes, cl, gol, p33, pg0, pg4; mutant |
PDB Entry: 3tgw (more details), 1.75 Å
SCOPe Domain Sequences for d3tgwa1:
Sequence, based on SEQRES records: (download)
>d3tgwa1 b.49.1.0 (A:11-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgvi
ftget
>d3tgwa1 b.49.1.0 (A:11-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggdcgviftg
et
Timeline for d3tgwa1: