Lineage for d1eeha1 (1eeh A:1-93)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833628Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 1833629Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 1833630Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)
  7. Species Escherichia coli [TaxId:562] [51987] (6 PDB entries)
  8. 1833649Domain d1eeha1: 1eeh A:1-93 [30654]
    Other proteins in same PDB: d1eeha2, d1eeha3
    complexed with uma

Details for d1eeha1

PDB Entry: 1eeh (more details), 1.9 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOPe Domain Sequences for d1eeha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeha1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d1eeha1:

Click to download the PDB-style file with coordinates for d1eeha1.
(The format of our PDB-style files is described here.)

Timeline for d1eeha1: