SCOPe 2.06: Domain d3ssaa3: 3ssa A:351-456

Lineage for d3ssaa3 (3ssa A:351-456)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (11 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [311201] (4 PDB entries)

8. Domain d3ssaa3: 3ssa A:351-456 [306517]
   Other proteins in same PDB: d3ssaa1, d3ssaa2, d3ssab1, d3ssab2
   automated match to d3j9tb3
   complexed with 1pe, aes, cl, gol, peg, pge; mutant

Details for d3ssaa3

PDB Entry: 3ssa, 1.7 Å

PDB Description: Crystal structure of subunit B mutant N157T of the A1AO ATP synthase

PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3ssaa3:

Sequence; same for both SEQRES and ATOM records:

>d3ssaa3 a.69.1.0 (A:351-456) automated matches {Methanosarcina mazei [TaxId: 192952]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpah

Timeline for d3ssaa3:

• d3ssaa3 is new in SCOPe 2.06-stable
  
• d3ssaa3 appears in SCOPe 2.07
  
• d3ssaa3 appears in the current release, SCOPe 2.08