Lineage for d3ssaa3 (3ssa A:351-456)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325855Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2325856Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2326080Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2326081Protein automated matches [254528] (12 species)
    not a true protein
  7. 2326164Species Methanosarcina mazei [TaxId:192952] [311201] (4 PDB entries)
  8. 2326166Domain d3ssaa3: 3ssa A:351-456 [306517]
    Other proteins in same PDB: d3ssaa1, d3ssaa2, d3ssab1, d3ssab2
    automated match to d3j9tb3
    complexed with 1pe, aes, cl, gol, peg, pge; mutant

Details for d3ssaa3

PDB Entry: 3ssa (more details), 1.7 Å

PDB Description: Crystal structure of subunit B mutant N157T of the A1AO ATP synthase
PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3ssaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ssaa3 a.69.1.0 (A:351-456) automated matches {Methanosarcina mazei [TaxId: 192952]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpah

SCOPe Domain Coordinates for d3ssaa3:

Click to download the PDB-style file with coordinates for d3ssaa3.
(The format of our PDB-style files is described here.)

Timeline for d3ssaa3: