Lineage for d3ssaa1 (3ssa A:12-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798831Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2798832Protein automated matches [254527] (17 species)
    not a true protein
  7. 2798936Species Methanosarcina mazei [TaxId:192952] [311341] (3 PDB entries)
  8. 2798937Domain d3ssaa1: 3ssa A:12-75 [306515]
    Other proteins in same PDB: d3ssaa2, d3ssaa3, d3ssab2, d3ssab3
    automated match to d3j9tb1
    complexed with 1pe, aes, cl, gol, peg, pge; mutant

Details for d3ssaa1

PDB Entry: 3ssa (more details), 1.7 Å

PDB Description: Crystal structure of subunit B mutant N157T of the A1AO ATP synthase
PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3ssaa1:

Sequence, based on SEQRES records: (download)

>d3ssaa1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgvif
tget

Sequence, based on observed residues (ATOM records): (download)

>d3ssaa1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 192952]}
agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtiftget

SCOPe Domain Coordinates for d3ssaa1:

Click to download the PDB-style file with coordinates for d3ssaa1.
(The format of our PDB-style files is described here.)

Timeline for d3ssaa1: