Lineage for d3sqab_ (3sqa B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155438Species Human (Homo sapiens) [TaxId:9606] [187072] (42 PDB entries)
  8. 2155470Domain d3sqab_: 3sqa B: [306510]
    automated match to d4i6na_
    complexed with ca

Details for d3sqab_

PDB Entry: 3sqa (more details), 2.3 Å

PDB Description: Crystal Structure of the UCH domain of UCH-L5 with 6 residues deleted
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase isozyme L5

SCOPe Domain Sequences for d3sqab_:

Sequence, based on SEQRES records: (download)

>d3sqab_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldglregpi
dlgacnqddwisavrpviekriqkysegeirfnlmaivsd

Sequence, based on observed residues (ATOM records): (download)

>d3sqab_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnaaatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarafhfvsyvpvngrlyeldglregpidlgacnqddwisavrp
viekriqkysegeirfnlmaivsd

SCOPe Domain Coordinates for d3sqab_:

Click to download the PDB-style file with coordinates for d3sqab_.
(The format of our PDB-style files is described here.)

Timeline for d3sqab_:

  • d3sqab_ is new in SCOPe 2.06-stable