Lineage for d4uaga1 (4uag A:1-93)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1352406Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 1352407Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) (S)
  5. 1352408Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 1352421Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)
  7. 1352422Species Escherichia coli [TaxId:562] [51987] (11 PDB entries)
  8. 1352424Domain d4uaga1: 4uag A:1-93 [30651]
    Other proteins in same PDB: d4uaga2, d4uaga3
    complexed with so4, uag, unx

Details for d4uaga1

PDB Entry: 4uag (more details), 1.66 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOPe Domain Sequences for d4uaga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uaga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d4uaga1:

Click to download the PDB-style file with coordinates for d4uaga1.
(The format of our PDB-style files is described here.)

Timeline for d4uaga1: