Lineage for d3sina_ (3sin A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111901Protein Formyltetrahydrofolate synthetase [52659] (1 species)
    modified P-loop; there are many insertions in the common fold
  7. 2111902Species Moorella thermoacetica [TaxId:1525] [52660] (8 PDB entries)
  8. 2111907Domain d3sina_: 3sin A: [306503]
    automated match to d1fpma_
    complexed with so4, xpo, zd9

Details for d3sina_

PDB Entry: 3sin (more details), 2.67 Å

PDB Description: Crystal Strucutre of N10-Formyltetrahydrofolate Synthetase with ZD9331 and Formylphosphate
PDB Compounds: (A:) Formate--tetrahydrofolate ligase

SCOPe Domain Sequences for d3sina_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sina_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]}
psdieiaqaakmkpvmelarglgiqedevelygkykakisldvyrrlkdkpdgklilvta
itptpagegktttsvgltdalarlgkrvmvclrepslgpsfgikggaagggyaqvvpmed
inlhftgdihavtyahnllaamvdnhlqqgnvlnidprtitwrrvidlndralrnivigl
ggkangvpretgfdisvasevmaclclasdlmdlkerfsrivvgytydgkpvtagdleaq
gsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalkladyvvteagf
gadlgaekfydvkcryagfkpdatvivatvralkmhggvpksdlatenlealregfanle
khienigkfgvpavvainafptdteaelnllyelcakagaevalswakggegglelarkv
lqtlesrpsnfhvlynldlsikdkiakiateiygadgvnytaeadkaiqryeslgygnlp
vvmaktqysfsddmtklgrprnftitvrevrlsaggrlivpitgaimtmpglpkrpaacn
ididadgvitg

SCOPe Domain Coordinates for d3sina_:

Click to download the PDB-style file with coordinates for d3sina_.
(The format of our PDB-style files is described here.)

Timeline for d3sina_:

  • d3sina_ is new in SCOPe 2.06-stable