| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries) |
| Domain d3shhb1: 3shh B:1-126 [306500] Other proteins in same PDB: d3shha2, d3shha3, d3shhb2, d3shhb3 automated match to d4hcha1 complexed with gol, mg, na, peg, tla |
PDB Entry: 3shh (more details), 1.7 Å
SCOPe Domain Sequences for d3shhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3shhb1 d.54.1.0 (B:1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
ykligg
Timeline for d3shhb1: