Lineage for d3shhb1 (3shh B:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947900Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries)
  8. 2947904Domain d3shhb1: 3shh B:1-126 [306500]
    Other proteins in same PDB: d3shha2, d3shha3, d3shhb2, d3shhb3
    automated match to d4hcha1
    complexed with gol, mg, na, peg, tla

Details for d3shhb1

PDB Entry: 3shh (more details), 1.7 Å

PDB Description: Crystal structure of glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium and L-tartrate
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d3shhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3shhb1 d.54.1.0 (B:1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
ykligg

SCOPe Domain Coordinates for d3shhb1:

Click to download the PDB-style file with coordinates for d3shhb1.
(The format of our PDB-style files is described here.)

Timeline for d3shhb1: