Lineage for d2uaga1 (2uag A:1-93)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458695Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2458696Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2458697Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 2458710Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)
  7. 2458711Species Escherichia coli [TaxId:562] [51987] (7 PDB entries)
  8. 2458713Domain d2uaga1: 2uag A:1-93 [30650]
    Other proteins in same PDB: d2uaga2, d2uaga3
    complexed with adp, mg, uma

Details for d2uaga1

PDB Entry: 2uag (more details), 1.7 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) protein (udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase)

SCOPe Domain Sequences for d2uaga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uaga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d2uaga1:

Click to download the PDB-style file with coordinates for d2uaga1.
(The format of our PDB-style files is described here.)

Timeline for d2uaga1: