Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) |
Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins) |
Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species) |
Species Escherichia coli [TaxId:562] [51987] (7 PDB entries) |
Domain d2uaga1: 2uag A:1-93 [30650] Other proteins in same PDB: d2uaga2, d2uaga3 complexed with adp, mg, uma |
PDB Entry: 2uag (more details), 1.7 Å
SCOPe Domain Sequences for d2uaga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uaga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde wlmaadlivaspgialahpslsaaadagieivg
Timeline for d2uaga1: