| Class g: Small proteins [56992] (100 folds) |
| Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily) Fe-S binding region and beta cap |
Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families) ![]() Pfam PF09360; PubMed 17766440 |
| Family g.97.1.0: automated matches [310676] (1 protein) not a true family |
| Protein automated matches [310877] (1 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311339] (2 PDB entries) |
| Domain d3s2ra_: 3s2r A: [306494] Other proteins in same PDB: d3s2rb2 automated match to d2qh7b_ complexed with fes; mutant |
PDB Entry: 3s2r (more details), 1.14 Å
SCOPe Domain Sequences for d3s2ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s2ra_ g.97.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginpeirknedkvvdsvvvtelsknitpycrcwrsgtfplcdgscvkhnkangdnvgpll
lkkq
Timeline for d3s2ra_: