SCOPe 2.08: Domain d3s2qa_: 3s2q A:

Lineage for d3s2qa_ (3s2q A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily)
   Fe-S binding region and beta cap

4. Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families)
   Pfam PF09360; PubMed 17766440

5. Family g.97.1.0: automated matches [310676] (1 protein)
   not a true family

6. Protein automated matches [310877] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311339] (2 PDB entries)

8. Domain d3s2qa_: 3s2q A: [306492]
   automated match to d2qh7b_
   complexed with fes, zn

Details for d3s2qa_

PDB Entry: 3s2q, 1.75 Å

PDB Description: The crystal structure of AT5g51720 (AT-NEET)

PDB Compounds: (A:) AT5g51720/MIO24_14

SCOPe Domain Sequences for d3s2qa_:

Sequence; same for both SEQRES and ATOM records:

>d3s2qa_ g.97.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gginpeirknedkvvdsvvvtelsknitpycrcwrsgtfplcdgshvkhnkangdnvgpl
llkkq

Timeline for d3s2qa_:

• d3s2qa_ first appeared in SCOPe 2.06
  
• d3s2qa_ appears in SCOPe 2.07