Lineage for d3s0sa_ (3s0s A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2778976Species Canavalia lineata [TaxId:28957] [193321] (5 PDB entries)
  8. 2778978Domain d3s0sa_: 3s0s A: [306491]
    automated match to d4i30a_
    complexed with abu, ade, ca, mn

Details for d3s0sa_

PDB Entry: 3s0s (more details), 1.89 Å

PDB Description: Crystal structure of a lectin from Canavalia maritima complexed with adenine and gamma-aminobutyric acid
PDB Compounds: (A:) Concanavalin-A

SCOPe Domain Sequences for d3s0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s0sa_ b.29.1.1 (A:) automated matches {Canavalia lineata [TaxId: 28957]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklkaaaa
aatnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d3s0sa_:

Click to download the PDB-style file with coordinates for d3s0sa_.
(The format of our PDB-style files is described here.)

Timeline for d3s0sa_: