Lineage for d1c0la1 (1c0l A:999-1193,A:1289-1361)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833526Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1833527Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 1833581Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
    This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold
  6. 1833582Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)
  7. 1833614Species Rhodotorula gracilis [TaxId:5286] [51982] (4 PDB entries)
  8. 1833617Domain d1c0la1: 1c0l A:999-1193,A:1289-1361 [30649]
    Other proteins in same PDB: d1c0la2
    complexed with fad, fla

Details for d1c0la1

PDB Entry: 1c0l (more details), 1.73 Å

PDB Description: d-amino acid oxidase: structure of substrate complexes at very high resolution reveal the chemical reacttion mechanism of flavin dehydrogenation
PDB Compounds: (A:) d-amino acid oxidase

SCOPe Domain Sequences for d1c0la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0la1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]}
lmmhsqkrvvvlgsgviglssalilarkgysvhilardlpedvssqtfaspwaganwtpf
mtltdgprqakweestfkkwvelvptghamwlkgtrrfaqnedgllghwykditpnyrpl
pssecppgaigvtydtlsvhapkycqylarelqklgatferrtvtsleqafdgadlvvna
tglgaksiagiddqaXrggprveaerivlpldrtksplslgrgsaraakekevtlvhayg
fssagyqqswgaaedvaqlvdeafqryhg

SCOPe Domain Coordinates for d1c0la1:

Click to download the PDB-style file with coordinates for d1c0la1.
(The format of our PDB-style files is described here.)

Timeline for d1c0la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c0la2