Lineage for d1c0la1 (1c0l A:999-1193,A:1289-1361)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119416Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 119417Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
  5. 119446Family c.4.1.2: D-amino acid oxidase, N-terminal domain [51979] (1 protein)
  6. 119447Protein D-amino acid oxidase, N-terminal domain [51980] (2 species)
  7. 119479Species Yeast (Rhodotorula gracilis) [51982] (4 PDB entries)
  8. 119482Domain d1c0la1: 1c0l A:999-1193,A:1289-1361 [30649]
    Other proteins in same PDB: d1c0la2

Details for d1c0la1

PDB Entry: 1c0l (more details), 1.73 Å

PDB Description: d-amino acid oxidase: structure of substrate complexes at very high resolution reveal the chemical reacttion mechanism of flavin dehydrogenation

SCOP Domain Sequences for d1c0la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0la1 c.4.1.2 (A:999-1193,A:1289-1361) D-amino acid oxidase, N-terminal domain {Yeast (Rhodotorula gracilis)}
lmmhsqkrvvvlgsgviglssalilarkgysvhilardlpedvssqtfaspwaganwtpf
mtltdgprqakweestfkkwvelvptghamwlkgtrrfaqnedgllghwykditpnyrpl
pssecppgaigvtydtlsvhapkycqylarelqklgatferrtvtsleqafdgadlvvna
tglgaksiagiddqaXrggprveaerivlpldrtksplslgrgsaraakekevtlvhayg
fssagyqqswgaaedvaqlvdeafqryhg

SCOP Domain Coordinates for d1c0la1:

Click to download the PDB-style file with coordinates for d1c0la1.
(The format of our PDB-style files is described here.)

Timeline for d1c0la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c0la2