SCOPe 2.07: Domain d3rvyb_: 3rvy B:

Lineage for d3rvyb_ (3rvy B:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)
   Pfam PF00520

5. Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
   Pfam PF08016

6. Protein NavAb sodium channel [310744] (1 species)

7. Species Arcobacter butzleri [TaxId:367737] [310997] (16 PDB entries)

8. Domain d3rvyb_: 3rvy B: [306482]
   automated match to d3rvza_
   complexed with px4

Details for d3rvyb_

PDB Entry: 3rvy, 2.7 Å

PDB Description: Crystal structure of the NavAb voltage-gated sodium channel (Ile217Cys, 2.7 A)

PDB Compounds: (B:) Ion transport protein

SCOPe Domain Sequences for d3rvyb_:

Sequence; same for both SEQRES and ATOM records:

>d3rvyb_ f.14.1.2 (B:) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaicvdam

Timeline for d3rvyb_:

• d3rvyb_ first appeared in SCOPe 2.06
  
• d3rvyb_ appears in the current release, SCOPe 2.08